PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_003313-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 444aa    MW: 49223.1 Da    PI: 8.2002
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_003313-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-165195147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E++++++a k++G   W++I +++g  +t+ q++s+ qk+
  AHYPO_003313-RA 51 RERWTEDEHKRFLEALKMYGRA-WRKIEEHVG-SKTAVQIRSHAQKF 95
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.02E-164599IPR009057Homeodomain-like
PROSITE profilePS5129420.94946100IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-948102IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-174998IPR006447Myb domain, plants
SMARTSM007171.3E-125098IPR001005SANT/Myb domain
PfamPF002491.8E-135194IPR001005SANT/Myb domain
CDDcd001671.82E-95396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MITSTISSQE ENYVPQSNLG SKILLMTRVQ SEAGENHIPK IRKAYTITKQ RERWTEDEHK  60
RFLEALKMYG RAWRKIEEHV GSKTAVQIRS HAQKFFSKVV RETSTSNSIS AEPIEIPPPR  120
PKRKPSHPYP RKLVLPSRKE MPMEHQARST SPNSSFSEQD NHSPASVMSF VASDTIASAD  180
SATPKSSLSP ISSGNFADQV AVMPCENNAS QGGLLLPNSL PIAPSSVKLE LFSYKESSEK  240
EDVASTKVLK LFGKDLVVPR NPSDSSTCSG KSTSSDMGEG VLQAYRNASK SGDIAVATAD  300
YQTFFSADRS TNQVEKPVPL PWWIFFKGIN ISPFGKPQEK EILREDSSAD SNSDSVNRGE  360
TPEKNWEVEA ESGICSPSSD KDGQILEESS PKTLEPTSLE KRTSFDDGRK GFVPYKRCLS  420
KRDMQFSTIT SEERESQRIR LCL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675239.10.0PREDICTED: protein REVEILLE 2 isoform X1
TrEMBLA0A0J8CMR10.0A0A0J8CMR1_BETVU; Uncharacterized protein
STRINGVIT_04s0079g00410.t017e-82(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.14e-40MYB_related family protein